PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 497aa    MW: 53562.3 Da    PI: 5.6397
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087240.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-39143203262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  XP_011087240.1 143 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSA 203
                     7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-30140200IPR003851Zinc finger, Dof-type
PfamPF027013.4E-32145201IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882147201IPR003851Zinc finger, Dof-type
PROSITE patternPS013610149185IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MKDVKEPEIK LFGRKIVLPE HGGVPAGGES SGESHGGSGG GADCDRCSEV SGGEGEEEKA  60
DEEKQPQGTE EDQDAETCET KPQGQEENLG EAEESHNPDA VVESDENPKT PSIDEGIVSE  120
EHPKTENGQS DATNGQQKTL KKPDKILPCP RCNSMDTKFC YYNNYNINQP RHFCKSCQRY  180
WTAGGTMRNV PVGAGRRKNK NSASHCRHIT ISEALQAARI DAPNGFHHPA FKPNGTVLSF  240
GPDSTLCESM ASALNLVDKR VPNGVKNGYY RPDHGSGSES CKNRENGDDC SNGSSVTASS  300
SVQDGGKNGP QQPLMHSING FPSPVPCIPG VAWPFPWNSA VPLPAMCPPA YPMPFYPAPY  360
WNCSLPNAWN VPWLSVPSPT VNQKATGSNP SSPLGKHSRN GELLKPKNTE GKEHLEPKNP  420
ESSIVVPKTL RIDDPEEAAK SSIWETLGIK YDTISREGLF KALQPKGDEK KQAVSASPVL  480
QANPAALSRS INFQEGA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0351624e-37BT035162.1 Zea mays full-length cDNA clone ZM_BFb0042O20 mRNA, complete cds.
GenBankBT0673164e-37BT067316.1 Zea mays full-length cDNA clone ZM_BFc0006N22 mRNA, complete cds.
GenBankEU9436274e-37EU943627.1 Zea mays clone 1638962 mRNA sequence.
GenBankEU9571714e-37EU957171.1 Zea mays clone 1584660 hypothetical protein mRNA, complete cds.
GenBankJX4284794e-37JX428479.1 Zea mays subsp. mays clone pUT3075 DOF21 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087240.10.0PREDICTED: cyclic dof factor 1
TrEMBLA0A068UVL60.0A0A068UVL6_COFCA; Uncharacterized protein
STRINGSolyc03g115940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-86cycling DOF factor 3